Antimicrobial Peptide AP00178

     
 

APD ID:

AP00178

 
 

Name/Class:

human neutrophil peptide-3 (HNP-3, HNP3, alpha Defensin, UCSS1a; primates, mammals, animals; lectin; ZZHh, BBS; 3S=S)

 
 

Source:

neutrophils; natural killer cells, monocytes; saliva; Homo sapiens

 
 

Sequence:

DCYCRIPACIAGERRYGTCIYQGRLWAFCC

 
 

Length:

30

 
 

Net charge:

2

 
 

Hydrophobic residue%:

50%

 
 

Boman Index:

1.42 kcal/mol

 
 

3D Structure:

Beta

 
 

Method:

X-Ray

 
 

SwissProt ID:

PDB ID: 1DFN   Go to PDB

 
 

Activity:

anti-Gram+ & Gram-, antiviral, antifungal, anti-HIV, Chemotactic, Enzyme inhibitor, Cancer cells

 
 

Additional info:

The dimeric structure of HNP-3 in the crystal is the first atomic structure for defensins solved by X-ray diffraction (Hill et al., 1991). Compared to HNP-2, HNP-3 contains one additional residue (Asp) at the N-terminus. The 3D structures remain the same. You can rotate, zoom, and view the dimeric crystal structure here in the PDB. Enzyme inhibitor: it inhibits protein kinase C (Charp et al., 1988). anti-toxin: HNP3 can partially protect human neutrophils against Panton-Valentine leukocidin of S. aureus by reducing PVL pore formation (Cardot-Martin E et al. 2015). UPdated 10/2015.

 
       
 

Title:

Primary structures of three human neutrophil defensins

 
 

Author:

Selsted ME, Harwig SS, Ganz T, Schilling JW, Lehrer RI1985

 
 

Reference:

J Clin Invest. 1985 Oct;76(4):1436-9. Pub-Med.

 
       

Close this window