Antimicrobial Peptide AP00158

     
 

APD ID:

AP00158

 
 

Name/Class:

Dermaseptin-S2 (DRS-S2; Dermaseptin S2, DRS S2, Dermaseptin II; DS II; UCLL1; frog, amphibians, animals; ZZP)

 
 

Source:

Sauvage's leaf frog, Phyllomedusa sauvagii, South America

 
 

Sequence:

ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ

 
 

Length:

34

 
 

Net charge:

3

 
 

Hydrophobic residue%:

52%

 
 

Boman Index:

-0.14 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

SwissProt ID: P80278  Go to SwissProt

 
 

Activity:

Anti-Gram+ & Gram-, Antifungal, candidacidal, Antiparasitic,

 
 

Additional info:

Active against A. caviae IP67-16T (MIC 1 uM), E. coli IP76-24 (MIC 2.5 uM), E. faecalis IP103214, S. aureus IP76-25 (MIC 10-20 uM), N. brasiliensis IP118079 (MIC 20 uM), S. cerevisiae IP118079 (MIC 5 uM), C. albicans IP884-65, IP886-65 (MIC 5-10 uM), C. neoformans IP960-67 and IP962-67 (MIC 1 uM), M. canis IP1194 (MIC 15 uM), T. rubrum IP2043-92 (MIC 35 uM), T. metagrophytes IP877-71 (MIC 20 uM), A. simii IP1063-74, mutant (MIC 20-30 uM), A. simii J43 (MIC 20 uM), A. niger IP218-53 and A. fumigatus IP1025-70 (MIC 20 uM). Activity against M. canis (MIC 10ug/ml), T. rubrum, E coli, C. neoformans, C. albicans (MIC 15ug/ml), A. simii, N. brasiliensis (MIC 30ug/ml) and A. caviae (MIC 30ug/ml). Based on the primary structure, it can be fitted to a class L amphipathic alpha helix. UPdated 4/2019 C. Wang Updated 5/2020 GW

 
       
 

Title:

The Vertebrate Peptide Antibiotics Dermaseptins Have Overlapping Structural Features but Target Specific Microorganisms

 
 

Author:

Mor A, Hani K, Nicolas P. 1994

 
 

Reference:

J Biol Chem. 1994;269(50):31635-31641.PubMed.

 
       

Close this window