Antimicrobial Peptide AP00158

     
 

APD ID:

AP00158

 
 

Name/Class:

Dermaseptin-S2 (DRS-S2; Dermaseptin S2, DRS S2, UCLL1; frog, amphibians, animals; ZZP)

 
 

Source:

Sauvage's leaf frog, Phyllomedusa sauvagii, South America

 
 

Sequence:

ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ

 
 

Length:

34

 
 

Net charge:

3

 
 

Hydrophobic residue%:

52%

 
 

Boman Index:

-0.14 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

SwissProt ID: P80278  Go to SwissProt

 
 

Activity:

Anti-Gram+ & Gram-, Antifungal, Antiparasitic,

 
 

Additional info:

Activity against M. canis (MIC 10ug/ml), T. rubrum, E coli, C. neoformans, C. albicans (MIC 15ug/ml), A. simii, N. brasiliensis (MIC 30ug/ml) and A. caviae (MIC 30ug/ml). Based on the primary structure, it can be fitted to a class L amphipathic alpha helix. UPdated 4/2019 C. Wang

 
       
 

Title:

Isolation and structure of novel defensive peptides from frog skin.

 
 

Author:

Mor A, Nicolas P.1994

 
 

Reference:

Eur. J. Biochem. 1994; 219:145-154.PubMed.

 
       

Close this window