Antimicrobial Peptide AP00149“>001493086.45 %92.14 %AVP
     
 

APD ID:

AP00149

 
 

Name/Class:

Rabbit kidney defensin 1 (RK-1, animals; UCSS1a; 3S=S)

 
 

Source:

kidney, Oryctolagus cuniculus

 
 

Sequence:

MPCSCKKYCDPWEVIDGSCGLFNSKYICCREK

 
 

Length:

32

 
 

Net charge:

1

 
 

Hydrophobic residue%:

40%

 
 

Boman Index:

1.53 kcal/mol

 
 

3D Structure:

Beta

 
 

Method:

NMR

 
 

SwissProt ID:

PDB ID: 1EWS   Go to PDB

 
 

Activity:

Anti-Gram+ & Gram-,

 
 

Additional info:

3 disulfide bridges:3,29; 5,19; 9,28. 3D structure was solved by Mcmanus AM et al. (2000) Biochemistry 39: 15757. You can rotate, zoom, and view the 3D structure here in the PDB . Active against E. coli. It can also activate epithelial ion channels in vitro. Updated 7/2013.

 
       
 

Title:

The isolation and characterization of a novel corticostatin/defensin-like peptide from the kidney.

 
 

Author:

Bateman A, MacLeod RJ, Lembessis P, Hu J, Esch F, Solomon S. 1996

 
 

Reference:

J Biol Chem. 1996 May 3;271(18):10654-9. Pub-Med

 
       

Close this window