Antimicrobial Peptide AP00139

     
 

APD ID:

AP00139

 
 

Name/Class:

Cecropin A (XXA; insects, arthropods, invertebrates, animals; ZZHa; ZZP)

 
 

Source:

jiant silk moth, Hyalophora cecropia

 
 

Sequence:

KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK

 
 

Length:

37

 
 

Net charge:

7

 
 

Hydrophobic residue%:

45%

 
 

Boman Index:

0.84 kcal/mol

 
 

3D Structure:

Helix

 
 

Method:

NMR

 
 

SwissProt ID:

SwissProt ID: P01507  Go to SwissProt

 
 

Activity:

anti-Gram+ & Gram-, antiviral, antiparasitic, anti-HIV, Cancer cells

 
 

Additional info:

This is the first inducible insect antimicrobial peptide fully characterized by Boman and colleagues. The paper was re-produced in J Immunol. 2009 Jun 1;182(11):6635-72 as a pillar article in immunology. Also read the comment of this work by JL Strominger (2009 Immunol 182:6633-4). Active against insect pathogens S. marcescens, P. aeruginosa, X. nematophilus, as well as other strains such as E. colo K12, B. megaterium (inhibition zone assays). 2D NMR studies revealed two helical domains (Helix1: 5-21; Helix2: 24-37) (Holak TA et al. 1988 Biochemistry 27:7620-7629). MOA: It also inhibits HIV by suppressing viral gene expression (J Gen Virol 1998; 79:731-40). Transgenic plants: expression of this peptide in rich improved plant resistance to pathogens (Plant Biotechnol J. 2008 Aug;6(6):585-608).

 
       
 

Title:

Sequence and specificity of two antibacterial proteins involved in insect immunity

 
 

Author:

Steiner H, Hultmark D, Engström A, Bennich H, Boman HG1981

 
 

Reference:

Nature. 1981 Jul 16;292(5820):246-8. PubMed.

 
       

Close this window