| |
APD ID: |
AP00139 |
|
| |
Name: |
Cecropin A (insect, invertebrates, animals; ZZHa) |
|
| |
Source: |
Hyalophora cecropia |
|
| |
Sequence: |
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK |
|
| |
Length: |
37 |
|
| |
Structure: |
Helix |
|
| |
Method: |
NMR |
|
| |
Additional info: |
2 alpha-helix. Helix1: 5-21; Helix2: 24-37. MOA: It inhibits HIV by suppressing viral gene expression (J Gen Virol 1998; 79:731-40). |
|
| |
Activity: |
Gram+ & Gram-, Virus, Cancer cells |
|
| |
Net charge: |
6 |
|
| |
Hydrophobic residue%: |
45% |
|
| |
Boman Index: |
0.84 kcal/mol |
|
| |
|
|
|
| |
SwissProt ID: |
SwissProt ID:
P01507 Go to SwissProt |
|
| |
Reference: |
Biochemistry 1988; 27: 7620-7629 |
|
| |
Author: |
Holak TA, Engstroem A, Kraulis PJ, Lindeberg G, Bennich H, Jones TA., Gronenborn AM., Clore GM. |
|
| |
Title: |
The solution conformation of the antibacterial peptide cecropin A: a nuclear magnetic resonance and dynamical simulated annealing study. |
|
| |
|
|
|