Antimicrobial Peptide AP00125

     
 

APD ID:

AP00125

 
 

Name/Class:

Cecropin B (XXA; insects, arthropods, invertebrates, animals)

 
 

Source:

giant silk moth, Hyalophora cecropia

 
 

Sequence:

KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAILS

 
 

Length:

37

 
 

Net charge:

8

 
 

Hydrophobic residue%:

48%

 
 

Boman Index:

0.86 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+ & Gram-,

 
 

Additional info:

See also Cecropin A (AP00139). Active against insect pathogens S. marcescens, P. aeruginosa, X. nematophilus, as well as other strains such as E. colo K12, B. megaterium (inhibition zone assays). A 35mer of this sequence (no c-terminal two residues) has been immobilized (Xu D et al., 2013).

 
       
 

Title:

Sequence and specificity of two antibacterial proteins involved in insect immunity

 
 

Author:

Steiner H, Hultmark D, Engström A, Bennich H, Boman HG1981

 
 

Reference:

Nature. 1981 Jul 16;292(5820):246-8. PubMed.

 
       

Close this window