Antimicrobial Peptide AP0005“>00052784.24 %98.34 %AVP
     
 

APD ID:

AP00005

 
 

Name/Class:

Andropin (insects, arthropods, invertebrates, animals)

 
 

Source:

Fruit fly, Drosophila melanogaster

 
 

Sequence:

VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK

 
 

Length:

34

 
 

Net charge:

1

 
 

Hydrophobic residue%:

50%

 
 

Boman Index:

0.55 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

SwissProt ID: P21663  Go to SwissProt

 
 

Activity:

Anti-Gram+,

 
 

Additional info:

Active against B. megatherium Bml 1 (MIC 11 uM), B. subtilis Bs11 (MIC 17 uM), and M. luteus Mill (MIC 20 uM) (provided by Chunfeng Wang). Andropin is constitutively expressed in the adult male ejaculatory duct in response to mating not bacterial infection. Andropin is less fungicidal than the cecropins (Insect Biochem Mol Biol. 1999;29:965-72). Along with other antimicrobial proteins, this peptide sterilizes the reproduction system of insects and protects sperms from being infected by bacteria (J Insect Physiol. 2001 Jun;47(6):617-622). Similarly, ceratotoxins are expressed in the female reproductive accesary glands and expressed during mating (see APD entries 414-417). Interestingly, a similar protecting antimicrobial peptide, ALL-38, exists in human genital systems (see APD entry 624). Updated 9/2017.

 
       
 

Title:

The andropin gene and its product, a male-specific antibacterial peptide in Drosophila melanogaster.

 
 

Author:

Samakovlis, C., Kylsten, P., Kimbrell, DA., Engstroem, A., Hultmark, D.1991

 
 

Reference:

EMBO J. 1991; 10:163-169. PubMed.

 
       

Close this window