Antimicrobial Peptide AP00041

     
 

APD ID:

AP00041

 
 

Name/Class:

Bovine Beta-defensin 6 (bBD-6, 3S=S, UCSS1a; cattle, ruminant, mammals; animals)

 
 

Source:

Bos taurus

 
 

Sequence:

QGVRNHVTCRIYGGFCVPIRCPGRTRQIGTCFGRPVKCCRRW

 
 

Length:

42

 
 

Net charge:

10

 
 

Hydrophobic residue%:

38%

 
 

Boman Index:

2.44 kcal/mol

 
 

3D Structure:

Bridge

 
 

SwissProt ID:

SwissProt ID: P46164  Go to SwissProt

 
 

Activity:

Anti-Gram+ & Gram-, Antifungal, candidacidal,

 
 

Additional info:

BETA-DEFENSIN familiy: 13 peptides share a highly conserved consensus sequence which form three disulfides. Active against B. subtilis CMCC 63501(MIC 8 uM), E. faecalis ATCC 29212 (MIC 2 uM), E. coli (MIC 1 uM), P. aeruginosa (ATCC 27853), S. enteritidis(MIC 4 uM), and C. albicans(MIC 16 uM) (MIC data provided by Chunfeng Wang). Updated 9/2017.

 
       
 

Title:

Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.

 
 

Author:

Selsted ME, Tang Y-Q, Morris WL, McGuire PA, Novotny MJ, Smith W, Henschen AH, Cullor JS.1993

 
 

Reference:

J. Biol. Chem. 1993; 268:6641-6648. PubMed.

 
       

Close this window