Antimicrobial Peptide AP00036

     
 

APD ID:

AP00036

 
 

Name/Class:

Bovine beta-defensin 1 (bBD-1, UCSS1a; cattle, ruminant, mammals; animals; 3S=S)

 
 

Source:

Bos taurus

 
 

Sequence:

DFASCHTNGGICLPNRCPGHMIQIGICFRPRVKCCRSW

 
 

Length:

38

 
 

Net charge:

6

 
 

Hydrophobic residue%:

44%

 
 

Boman Index:

1.55 kcal/mol

 
 

3D Structure:

Bridge

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

anti-Gram+ & Gram-,

 
 

Additional info:

3 disulfide bridge: 5, 34; 12, 27; 17, 35. Active against a fresh clinical isolate of E. coli from bovine mastitis milk. However, it had very weak activity against clinical mastitis isolates of S. aureus and S. uberis in 10 mM NaPO4 buffer (MIC data provided by Chunfeng Wang). Updated 9/2017.

 
       
 

Title:

Molecular and functional characterization of bovine beta-defensin-1

 
 

Author:

Aono S, Li C, Zhang G, Kemppainen RJ, Gard J, Lu W, Hu X, Schwartz DD, Morrison EE, Dykstra C, Shi J.1993

 
 

Reference:

Vet Immunol Immunopathol. 2006 Sep 15;113(1-2):181-90. PubMed.

 
       

Close this window