Antimicrobial Peptide AP00032

     
 

APD ID:

AP00032

 
 

Name/Class:

Bactericidin B-3 (insects, arthropods, invertebrates, animals)

 
 

Source:

Tobacco hornworm, Manduca sexta

 
 

Sequence:

WNPFKELERAGQRVRDAIISAGPAVATVGQAAAIARG

 
 

Length:

37

 
 

Net charge:

2

 
 

Hydrophobic residue%:

48%

 
 

Boman Index:

1.46 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

SwissProt ID: P14663  Go to SwissProt

 
 

Activity:

anti-Gram+ & Gram-, Mammalian cells,

 
 

Additional info:

BELONGS TO THE CECROPIN FAMILY

 
       
 

Title:

A family of bacteria-regulated, cecropin D-like peptides from Manduca sexta.

 
 

Author:

Dickinson L, Russel V, Dunn PE.1988

 
 

Reference:

J. Biol. Chem. 1988; 263:19424-19429. PubMed.

 
       

Close this window