Antimicrobial Peptide AP00011

     
 

APD ID:

AP00011

 
 

Name/Class:

Bactericidin B-2 (insects, arthropods, invertebrates, animals)

 
 

Source:

Tobacco hornworm Manduca sexta

 
 

Sequence:

WNPFKELERAGQRVRDAVISAAPAVATVGQAAAIARG

 
 

Length:

37

 
 

Net charge:

2

 
 

Hydrophobic residue%:

51%

 
 

Boman Index:

1.46 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

SwissProt ID: P14662  Go to SwissProt

 
 

Activity:

anti-Gram+ & Gram-, Mammalian cells,

 
 

Additional info:

This study revealed the syntheis of mRNA within 5 hrs in various tissues (not tissue-specific) after induction and AMPs were detected subsequently.

 
       
 

Title:

A family of bacteria-regulated, cecropin D-like peptides from Manduca sexta.

 
 

Author:

Dickinson L., Russel V., Dunn PE.1988

 
 

Reference:

J. Biol. Chem. 263:19424-19429(1988). PubMed.

 
       

Close this window