| |
APD ID: |
AP00011 |
|
| |
Name: |
Bactericidin B2 (insect, invertebrates, animals) |
|
| |
Source: |
Tobacco hornworm |
|
| |
Sequence: |
WNPFKELERAGQRVRDAVISAAPAVATVGQAAAIARG |
|
| |
Length: |
37 |
|
| |
Structure: |
Unknown |
|
| |
Activity: |
Gram+ & Gram-, Mammalian cells, |
|
| |
Net charge: |
2 |
|
| |
Hydrophobic residue%: |
51% |
|
| |
Boman Index: |
1.46 kcal/mol |
|
| |
|
|
|
| |
SwissProt ID: |
SwissProt ID:
P14662 Go to SwissProt |
|
| |
Reference: |
J. Biol. Chem. 263:19424-19429(1988) |
|
| |
Author: |
Dickinson L., Russel V., Dunn PE. |
|
| |
Title: |
A family of bacteria-regulated, cecropin D-like peptides from Manduca sexta. |
|
| |
|
|
|