| |
APD ID: |
AP00005 |
|
| |
Name: |
Andropin (insect, fly, invertebrates, animals) |
|
| |
Source: |
Fruit fly, Drosophila melanogaster |
|
| |
Sequence: |
VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK |
|
| |
Length: |
34 |
|
| |
Structure: |
Unknown |
|
| |
Additional info: |
Andropin is less fungicidal than the cecropins, and Drosophila cecropin A is somewhat more potent than cecropin B (Insect Biochem Mol Biol. 1999;29:965-72). Along with other antimicrobial proteins, this peptide sterilizes the production system of insects and protects sperms from being infected by bacteria (J Insect Physiol. 2001 Jun;47(6):617-622). It appears that a similar protecting antimicrobial peptide, ALL-38, exists in human genital systems (see APD entry 624). |
|
| |
Activity: |
Gram+, |
|
| |
Net charge: |
1 |
|
| |
Hydrophobic residue%: |
50% |
|
| |
Boman Index: |
0.55 kcal/mol |
|
| |
|
|
|
| |
SwissProt ID: |
SwissProt ID:
P21663 Go to SwissProt |
|
| |
Reference: |
EMBO J. 1991; 10:163-169 |
|
| |
Author: |
Samakovlis, C., Kylsten, P., Kimbrell, DA., Engstroem, A., Hultmark, D. |
|
| |
Title: |
The andropin gene and its product, a male-specific antibacterial peptide in Drosophila melanogaster. |
|
| |
|
|
|
Close this window
|