| |
APD ID: |
AP00004 |
|
| |
Name: |
Ct-AMP1 (CtAMP1, C. ternatea-antimicrobial peptide 1, plant defensin) |
|
| |
Source: |
Turnip |
|
| |
Sequence: |
NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFDC |
|
| |
Length: |
49 |
|
| |
Structure: |
Bridge |
|
| |
Additional info: |
Replaced 7/26/2008 by GW. |
|
| |
Activity: |
Gram+, Fungi, |
|
| |
Net charge: |
5 |
|
| |
Hydrophobic residue%: |
36% |
|
| |
Boman Index: |
2.43 kcal/mol |
|
| |
|
|
|
| |
SwissProt ID: |
Reference ID:
Ref |
|
| |
Reference: |
FEBS Lett. 1995 Jul 17;368(2):257-62 |
|
| |
Author: |
Osborn RW, De Samblanx GW, Thevissen K, Goderis I, Torrekens S, Van Leuven F, Attenborough S, Rees SB, Broekaert WF |
|
| |
Title: |
Isolation and characterisation of plant defensins from seeds of Asteraceae, Fabaceae, Hippocastanaceae and Saxifragaceae. |
|
| |
|
|
|
Close this window
|