Antimicrobial Peptide AP00004

     
 

APD ID:

AP00004

 
 

Name/Class:

Ct-AMP1 (CtAMP1, C. ternatea-antimicrobial peptide 1; defensins; 4S=S, UCSS1a; plants)

 
 

Source:

Clitoria ternatea

 
 

Sequence:

NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFDC

 
 

Length:

49

 
 

Net charge:

5

 
 

Hydrophobic residue%:

36%

 
 

Boman Index:

2.43 kcal/mol

 
 

3D Structure:

Bridge

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

anti-Gram+, antifungal,

 
 

Additional info:

In medium A supplemented with 1 mM CaCl2 and 50 mM KCl, the peptide is active against fungi B. cinerea (IC50 20 ug/ml), C. sphaerospermum (IC50 6 ug/ml), F. culmorum (IC50 10 ug/ml), L. maculans (IC50 6 ug/ml), P. digitatum (IC50 20 ug/ml), S. tritici (IC50 2 ug/ml), and V. albo-atrum (IC50 2 ug/ml) (FEBS Lett. 1995 Jul 17;368(2):257-62). Replaced 7/2008; updated Jan2017, GW.

 
       
 

Title:

Isolation and characterisation of plant defensins from seeds of Asteraceae, Fabaceae, Hippocastanaceae and Saxifragaceae.

 
 

Author:

Osborn RW, De Samblanx GW, Thevissen K, Goderis I, Torrekens S, Van Leuven F, Attenborough S, Rees SB, Broekaert WF1995

 
 

Reference:

FEBS Lett. 1995 Jul 17;368(2):257-62. PubMed.

 
       

Close this window