| |
APD ID: |
AP00003 |
|
| |
Name: |
Hs-AFP1 (HsAFP1, H. sanguinea antifungal protein 1, BBMm_lipid?, plant defensin) |
|
| |
Source: |
Heuchera sanguinea |
|
| |
Sequence: |
DGVKLCDVPSGTWSGHCGSSSKCSQQCKDREHFAYGGACHYQFPSVKCFCKRQC |
|
| |
Length: |
54 |
|
| |
Structure: |
Bridge |
|
| |
Additional info: |
Both non-germinated and germinated conidia of F. moniliforme were susceptible to these peptides. Overall, F. moniliforme was more susceptible than A. flavus to the peptide. The peptide bound strongly to chitin, mannan, galactocerebrosides, and sphingomyelin (Mycopathologia. 1998-1999;144:87-91). [35S]Hs-AFP1 also bound specifically and reversibly to microsomal membranes derived from N. crassa hyphae with a Kd of 27 nM and a Bmax of 102 pmol/mg protein. The similarity in Kd value between binding sites on hyphae and microsomes indicates that Hs-AFP1 binding sites reside on the plasma membrane. Rs-AFP2 itself was able to compete with [35S]Hs-AFP1.
(J Biol Chem. 1997;272:32176-81). The orginal APD entry was replaced 7/26/2008 by GW. |
|
| |
Activity: |
Fungi, |
|
| |
Net charge: |
6 |
|
| |
Hydrophobic residue%: |
33% |
|
| |
Boman Index: |
1.95 kcal/mol |
|
| |
|
|
|
| |
SwissProt ID: |
Reference ID:
Ref |
|
| |
Reference: |
FEBS Lett. 1995 Jul 17;368(2):257-62 |
|
| |
Author: |
Osborn RW, De Samblanx GW, Thevissen K, Goderis I, Torrekens S, Van Leuven F, Attenborough S, Rees SB, Broekaert WF
|
|
| |
Title: |
Isolation and characterisation of plant defensins from seeds of Asteraceae, Fabaceae, Hippocastanaceae and Saxifragaceae. |
|
| |
|
|
|
Close this window
|