| |
APD ID: |
AP00002 |
|
| |
Name: |
ABAECIN (insect, honeybee, invertebrates, animals) |
|
| |
Source: |
Apis mellifera L. |
|
| |
Sequence: |
YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY |
|
| |
Length: |
34 |
|
| |
Structure: |
Rich |
|
| |
Additional info: |
Rich in P. The highest observed specific activity of the peptide was against an apidaecin-resistant Xanthomonas strain. Relish regulates expression of antimicrobial peptide genes in the honeybee, Apis mellifera, shown by RNA interference (Insect Mol Biol. 2007 Dec;16(6):753-9). Updated 10/2008. |
|
| |
Activity: |
Gram+ & Gram-, |
|
| |
Net charge: |
4 |
|
| |
Hydrophobic residue%: |
23% |
|
| |
Boman Index: |
1.19 kcal/mol |
|
| |
|
|
|
| |
SwissProt ID: |
SwissProt ID:
P15450 Go to SwissProt |
|
| |
Reference: |
Eur J Biochem. 1990 Jan 26;187(2):381-6. |
|
| |
Author: |
Casteels P, Ampe C, Riviere L, Van Damme J, Elicone C, Fleming M, Jacobs F, Tempst P. |
|
| |
Title: |
Isolation and characterization of abaecin, a major antibacterial response peptide in the honeybee (Apis mellifera). |
|
| |
|
|
|
Close this window
|