Antimicrobial Peptide AP00002

     
 

APD ID:

AP00002

 
 

Name/Class:

Abaecin (Pro-rich; insects, arthropods, invertebrates, animals)

 
 

Source:

honeybee, Apis mellifera L.

 
 

Sequence:

YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY

 
 

Length:

34

 
 

Net charge:

4

 
 

Hydrophobic residue%:

23%

 
 

Boman Index:

1.19 kcal/mol

 
 

3D Structure:

Rich

 
 

SwissProt ID:

SwissProt ID: P15450  Go to SwissProt

 
 

Activity:

anti-Gram+ & Gram-,

 
 

Additional info:

Rich in P. Active against A. tumefaciens Gembloux A, E. salicis NCPPB 2530, E. coli NCTC 9001 (MIC 25-50 ug/ml), E. coli NCTC 9001*, E. coli K514 (MIC 10-25 ug/ml), P. syringae pv. tomamta NCPPB 1105 (MIC 25-50 ug.ml), X. campestris pv. vesicatoria LMG 905 (MIC 5-10 ug/ml), and Gram-positive bacteria B. megaterium OMB 1551 (MIC 10-25 ug/ml) and M. luteus (M. lysodeikticus) LMG 4050 (MIC 10-25 ug/ml). Thus, the highest observed specific activity of the peptide was against an apidaecin-resistant Xanthomonas strain. Relish regulates expression of antimicrobial peptide genes in the honeybee, Apis mellifera, shown by RNA interference (Insect Mol Biol. 2007 Dec;16(6):753-9). APD Updated 10/2008. name corrected 5/2014 GW.

 
       
 

Title:

Isolation and characterization of abaecin, a major antibacterial response peptide in the honeybee (Apis mellifera).

 
 

Author:

Casteels P, Ampe C, Riviere L, Van Damme J, Elicone C, Fleming M, Jacobs F, Tempst P.1990

 
 

Reference:

Eur J Biochem. 1990 Jan 26;187(2):381-6. PubMed.

 
       

Close this window